Host taxon 9606
Protein NP_001004440.1
chemokine-like protein TAFA-3 isoform 2 precursor
Homo sapiens
Gene TAFA3, UniProt Q7Z5A8
>NP_001004440.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|chemokine-like protein TAFA-3 isoform 2 precursor
MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCSCFSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGVRWSPACRGRSVRCSRTCRDGAAAVDTKSKPPRSHDSSWGSRPGQERLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.71 | -1.71440599514912 | 0.034 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)