Host taxon 9606
Protein NP_116287.3
centrosomal protein of 19 kDa isoform 1
Homo sapiens
Gene CEP19, UniProt Q96LK0
>NP_116287.3|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|centrosomal protein of 19 kDa isoform 1
MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.22 | -1.2151426374417 | 0.0037 | 25649146 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)