Host taxon 9606
Protein NP_001012525.1
centromere protein W isoform b
Homo sapiens
Gene CENPW, UniProt Q5EE01
>NP_001012525.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|centromere protein W isoform b
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.17 | -1.16933260098446 | 0.0079 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)