Host taxon 9606
Protein NP_001239225.1
CCAAT/enhancer-binding protein gamma
Homo sapiens
Gene CEBPG, UniProt P53567
>NP_001239225.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|CCAAT/enhancer-binding protein gamma
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.13 | -1.12934478054553 | 2.0e-14 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)