Host taxon 9606
Protein NP_001123466.1
BTB/POZ domain-containing protein KCTD15 isoform 2
Homo sapiens
Gene KCTD15, UniProt Q96SI1
>NP_001123466.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|BTB/POZ domain-containing protein KCTD15 isoform 2
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.21 | -1.21013672560083 | 0.0018 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)