Host taxon 9606
Protein NP_001012270.1
baculoviral IAP repeat-containing protein 5 isoform 2
Homo sapiens
Gene BIRC5, UniProt O15392
>NP_001012270.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|baculoviral IAP repeat-containing protein 5 isoform 2
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQGLFPGATSLPVGPLAMS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.25 | -1.24847859709824 | 0.05 | 25649146 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)