Host taxon 9606
Protein NP_001284505.1
astrocytic phosphoprotein PEA-15 isoform a
Homo sapiens
Gene PEA15, UniProt Q15121
>NP_001284505.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|astrocytic phosphoprotein PEA-15 isoform a
MEDEGNKLCQAPPWPGQTSPVMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.08 | -1.07762898060547 | 0.00023 | 25649146 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)