Host taxon 9606
Protein NP_000624.2
apoptosis regulator Bcl-2 isoform alpha
Homo sapiens
Gene BCL2, UniProt P10415
>NP_000624.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|apoptosis regulator Bcl-2 isoform alpha
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.85 | -0.85133633280888 | 0.011 | 25649146 | |
Retrieved 1 of 3 entries in 2.2 ms
(Link to these results)