Host taxon 9606
Protein NP_001634.1
apolipoprotein A-II preproprotein
Homo sapiens
Gene APOA2, UniProt P02652
>NP_001634.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|apolipoprotein A-II preproprotein
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.79 | 1.79494201971872 | 0.023 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)