Host taxon 9606
Protein NP_005820.1
AP-3 complex subunit sigma-2
Homo sapiens
Gene AP3S2, UniProt P59780
>NP_005820.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|AP-3 complex subunit sigma-2
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.87 | -0.868772263734178 | 0.0044 | 25649146 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)