Host taxon 9606
Protein NP_644815.1
anaphase-promoting complex subunit CDC26
Homo sapiens
Gene CDC26, UniProt Q8NHZ8
>NP_644815.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|anaphase-promoting complex subunit CDC26
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.26 | -1.25759088258701 | 0.00015 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)