Host taxon 9606
Protein NP_872297.2
AN1-type zinc finger protein 2A isoform 1
Homo sapiens
Gene ZFAND2A, UniProt Q8N6M9
>NP_872297.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|AN1-type zinc finger protein 2A isoform 1
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.31 | -1.30865607091782 | 9.5e-8 | 25649146 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)