Host taxon 9606
Protein NP_004427.1
alpha-endosulfine isoform 3
Homo sapiens
Gene ENSA, UniProt O43768
>NP_004427.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|alpha-endosulfine isoform 3
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.06 | -1.05805367730749 | 3.0e-9 | 25649146 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)