Host taxon 9606
Protein NP_001002919.2
ALK and LTK ligand 2 precursor
Homo sapiens
Gene ALKAL2, UniProt Q6UX46
>NP_001002919.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ALK and LTK ligand 2 precursor
MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.09 | 2.09484083511632 | 0.0049 | 25649146 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)