Host taxon 9606
Protein NP_001266285.1
acyl-protein thioesterase 1 isoform 2
Homo sapiens
Gene LYPLA1, UniProt O75608
>NP_001266285.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|acyl-protein thioesterase 1 isoform 2
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.64 | 0.637974539170517 | 0.017 | 25649146 | |
Retrieved 1 of 4 entries in 1.9 ms
(Link to these results)