Host taxon 9606
Protein NP_001265485.1
actin-related protein 2/3 complex subunit 3 isoform 1
Homo sapiens
Gene ARPC3, UniProt O15145
>NP_001265485.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|actin-related protein 2/3 complex subunit 3 isoform 1
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.33 | -0.333491491400385 | 0.034 | 25649146 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)