Host taxon 9606
Protein NP_036536.2
acidic leucine-rich nuclear phosphoprotein 32 family member D
Homo sapiens
Gene ANP32D, UniProt O95626
>NP_036536.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|acidic leucine-rich nuclear phosphoprotein 32 family member D
MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANLPKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDLFTCEVTNLNNY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ -3.17 | -3.17400163932947 | 0.00015 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)