Host taxon 9606
Protein NP_006296.1
acidic leucine-rich nuclear phosphoprotein 32 family member A
Homo sapiens
Gene ANP32A, UniProt P39687
>NP_006296.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|acidic leucine-rich nuclear phosphoprotein 32 family member A
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.18 | -1.18099644068653 | 1.1e-18 | 25649146 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)