Host taxon 9606
Protein NP_004833.1
A-kinase anchoring protein 7 isoform alpha
Homo sapiens
Gene AKAP7, UniProt O43687
>NP_004833.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|A-kinase anchoring protein 7 isoform alpha
MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.82 | 1.82245342449825 | 0.017 | 25649146 | |
Retrieved 1 of 4 entries in 1.3 ms
(Link to these results)