Host taxon 9606
Protein NP_000992.1
60S ribosomal protein L36a-like
Homo sapiens
Gene RPL36AL, UniProt Q969Q0
>NP_000992.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|60S ribosomal protein L36a-like
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.49 | -1.49406509480352 | 2.8e-17 | 25649146 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)