Host taxon 9606
Protein NP_001180272.1
39S ribosomal protein S18a, mitochondrial isoform 2 precursor
Homo sapiens
Gene MRPS18A, UniProt Q9NVS2
>NP_001180272.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|39S ribosomal protein S18a, mitochondrial isoform 2 precursor
MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.74 | -0.73731743242207 | 0.0028 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)