Host taxon 9606
Protein NP_848026.1
39S ribosomal protein L52, mitochondrial isoform a
Homo sapiens
Gene MRPL52, UniProt Q86TS9
>NP_848026.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|39S ribosomal protein L52, mitochondrial isoform a
MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.65 | -0.651133505156041 | 8.0e-5 | 25649146 | |
Retrieved 1 of 2 entries in 1.5 ms
(Link to these results)