Host taxon 9606
Protein NP_001284698.1
28S ribosomal protein S18c, mitochondrial isoform 3
Homo sapiens
Gene MRPS18C, UniProt Q9Y3D5
>NP_001284698.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|28S ribosomal protein S18c, mitochondrial isoform 3
MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQVFVGRNRKKSQKQLRELK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.61 | -0.611247173685939 | 0.024 | 25649146 | |
Retrieved 1 of 3 entries in 1.7 ms
(Link to these results)