Host taxon 9606
Protein NP_060611.2
28S ribosomal protein S10, mitochondrial
Homo sapiens
Gene MRPS10, UniProt P82664
>NP_060611.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|28S ribosomal protein S10, mitochondrial
MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.72 | -0.72366058929853 | 8.8e-6 | 25649146 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)