Host taxon 9606
Protein NP_006295.1
26S proteasome complex subunit SEM1
Homo sapiens
Gene SEM1, UniProt P60896
>NP_006295.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|26S proteasome complex subunit SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ -2.38 | -2.37678202990505 | 1.3e-35 | 25649146 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)