Host taxon 9606
Protein NP_001035975.1
zinc finger protein 706
Homo sapiens
Gene ZNF706, UniProt Q9Y5V0
>NP_001035975.1|Haemophilus ducreyi 35000HP|zinc finger protein 706
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.65 | -0.648184866047718 | 0.0014 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)