Host taxon 9606
Protein NP_056955.2
zinc finger protein 593
Homo sapiens
Gene ZNF593, UniProt O00488
>NP_056955.2|Haemophilus ducreyi 35000HP|zinc finger protein 593
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.28 | 1.2806762807025 | 0.0074 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)