Host taxon 9606
Protein NP_001258085.3
zinc finger protein 41 homolog
Homo sapiens
Gene ZFP41, UniProt Q8N8Y5
>NP_001258085.3|Haemophilus ducreyi 35000HP|zinc finger protein 41 homolog
MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.75 | -0.753931472661517 | 2.6e-10 | 31213562 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)