Host taxon 9606
Protein NP_001153655.1
zinc finger protein 138 isoform 2
Homo sapiens
Gene ZNF138, UniProt P52744
>NP_001153655.1|Haemophilus ducreyi 35000HP|zinc finger protein 138 isoform 2
MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFLDLITCLEQGKEPWNMKRHEMVVAKHSAVAFTFDLSGLNILSFQSILPFVSALYVMGNRNQCLQKHLEARNKDLCVLVLPKTFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.15 | -1.14780158295929 | 2.9e-9 | 31213562 | |
Retrieved 1 of 5 entries in 1.1 ms
(Link to these results)