Host taxon 9606
Protein NP_001230669.1
zinc finger protein 124 isoform 2
Homo sapiens
Gene ZNF124, UniProt Q15973
>NP_001230669.1|Haemophilus ducreyi 35000HP|zinc finger protein 124 isoform 2
MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLASIGNKGEDQSIEDQYKNSSRNLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.39 | 0.385227347663438 | 0.04 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)