Host taxon 9606
Protein NP_001003692.1
zinc finger matrin-type protein 5
Homo sapiens
Gene ZMAT5, UniProt Q9UDW3
>NP_001003692.1|Haemophilus ducreyi 35000HP|zinc finger matrin-type protein 5
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.25 | 1.24658759913719 | 0.00055 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)