Host taxon 9606
Protein NP_001013645.1
zinc finger C2HC domain-containing protein 1B
Homo sapiens
Gene ZC2HC1B, UniProt Q5TFG8
>NP_001013645.1|Haemophilus ducreyi 35000HP|zinc finger C2HC domain-containing protein 1B
MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFCKDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAKLRQGFSKSSKKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.22 | -1.21756031036059 | 0.0055 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)