Host taxon 9606
Protein NP_057137.1
WASH complex subunit 3 isoform 1
Homo sapiens
Gene WASHC3, UniProt Q9Y3C0
>NP_057137.1|Haemophilus ducreyi 35000HP|WASH complex subunit 3 isoform 1
MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.55 | 0.54532082235018 | 0.00043 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)