Host taxon 9606
Protein NP_742002.1
WAP four-disulfide core domain protein 13 precursor
Homo sapiens
Gene WFDC13, UniProt Q8IUB5
>NP_742002.1|Haemophilus ducreyi 35000HP|WAP four-disulfide core domain protein 13 precursor
MKPVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQCCSSFCGIVCSSETFQKRNRIKHKGSEVIMPAN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.46 | -2.45955237271187 | 7.6e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)