Host taxon 9606
Protein NP_001298240.1
vitamin K epoxide reductase complex subunit 1 isoform 3 precursor
Homo sapiens
Gene VKORC1, UniProt Q9BQB6
>NP_001298240.1|Haemophilus ducreyi 35000HP|vitamin K epoxide reductase complex subunit 1 isoform 3 precursor
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLEMVSRHVAQAGLKQSVCLSLPKCWGDYRRCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.28 | 1.27500746344955 | 8.2e-8 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)