Host taxon 9606
Protein NP_057156.1
vesicle transport protein GOT1B
Homo sapiens
Gene GOLT1B, UniProt Q9Y3E0
>NP_057156.1|Haemophilus ducreyi 35000HP|vesicle transport protein GOT1B
MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.49 | 0.494508991880209 | 0.0041 | 31213562 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)