Host taxon 9606
Protein NP_001185838.1
V-type proton ATPase subunit F isoform 2
Homo sapiens
Gene ATP6V1F, UniProt Q16864
>NP_001185838.1|Haemophilus ducreyi 35000HP|V-type proton ATPase subunit F isoform 2
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.13 | 1.13396701694763 | 0.00012 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)