Host taxon 9606
Protein NP_001034546.1
V-type proton ATPase 21 kDa proteolipid subunit isoform 2
Homo sapiens
Gene ATP6V0B, UniProt Q99437
>NP_001034546.1|Haemophilus ducreyi 35000HP|V-type proton ATPase 21 kDa proteolipid subunit isoform 2
MWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.24 | 1.23900418241247 | 0.00063 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)