Host taxon 9606
Protein NP_001240778.1
V-set domain-containing T-cell activation inhibitor 1 isoform 2
Homo sapiens
Gene VTCN1, UniProt Q7Z7D3
>NP_001240778.1|Haemophilus ducreyi 35000HP|V-set domain-containing T-cell activation inhibitor 1 isoform 2
MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.4 | -1.39958566223581 | 0.00021 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)