Host taxon 9606
Protein NP_001188403.1
UPF0711 protein C18orf21 isoform b
Homo sapiens
Gene C18orf21, UniProt Q32NC0
>NP_001188403.1|Haemophilus ducreyi 35000HP|UPF0711 protein C18orf21 isoform b
MVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.87 | 0.87370067079542 | 4.5e-5 | 31213562 | |
Retrieved 1 of 3 entries in 2.1 ms
(Link to these results)