Host taxon 9606
Protein NP_001034229.1
UPF0687 protein C20orf27 isoform 1
Homo sapiens
Gene C20orf27, UniProt Q9GZN8
>NP_001034229.1|Haemophilus ducreyi 35000HP|UPF0687 protein C20orf27 isoform 1
MAAANKGKCLPGVVGLAQALPVGPGRRAIAAGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.51 | 0.514711367748382 | 0.0018 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)