Host taxon 9606
Protein NP_001001795.1
UPF0598 protein C8orf82
Homo sapiens
Gene C8orf82, UniProt Q6P1X6
>NP_001001795.1|Haemophilus ducreyi 35000HP|UPF0598 protein C8orf82
MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPALPSHVRWQGRRLALTMDLAPLLLAARSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.51 | -0.508974825748935 | 0.00051 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)