Host taxon 9606
Protein NP_001013671.2
UPF0561 protein C2orf68
Homo sapiens
Gene C2orf68, UniProt Q2NKX9
>NP_001013671.2|Haemophilus ducreyi 35000HP|UPF0561 protein C2orf68
MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.28 | -0.277263101459775 | 0.033 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)