Host taxon 9606
Protein NP_079014.1
UPF0454 protein C12orf49 isoform 1 precursor
Homo sapiens
Gene C12orf49, UniProt Q9H741
>NP_079014.1|Haemophilus ducreyi 35000HP|UPF0454 protein C12orf49 isoform 1 precursor
MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.41 | 0.414502962645611 | 0.012 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)