Host taxon 9606
Protein NP_001153587.1
UPF0235 protein C15orf40 isoform d
Homo sapiens
Gene C15orf40, UniProt Q8WUR7
>NP_001153587.1|Haemophilus ducreyi 35000HP|UPF0235 protein C15orf40 isoform d
MLRLRSGLRHLRATPNTRGSARLLCAEMPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKTGSCYIAQAGLELLASSDLPASASQSAGITGVSHHTQPALLLISL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.66 | -0.656593002851121 | 0.00016 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)