Host taxon 9606
Protein NP_001193991.1
UPF0193 protein EVG1 isoform 2
Homo sapiens
Gene C22orf23, UniProt Q9BZE7
>NP_001193991.1|Haemophilus ducreyi 35000HP|UPF0193 protein EVG1 isoform 2
MASQKQMEVVTKGTGFRRRPKTITYTPGTCELLRGGDALPLQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEELRKGLATT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.6 | -0.604300858106678 | 0.00053 | 31213562 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)