Host taxon 9606
Protein NP_001129955.1
uncharacterized protein CFAP97D1 isoform 1
Homo sapiens
Gene CFAP97D1, UniProt B2RV13
>NP_001129955.1|Haemophilus ducreyi 35000HP|uncharacterized protein CFAP97D1 isoform 1
MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRYLLSQNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.41 | 1.40819381817493 | 0.0043 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)