Host taxon 9606
Protein NP_997394.1
uncharacterized protein C9orf139
Homo sapiens
Gene C9orf139, UniProt Q6ZV77
>NP_997394.1|Haemophilus ducreyi 35000HP|uncharacterized protein C9orf139
MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLPRLRVTRPLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSCVGTCELANGARGFCPEMGQNESLSEERKGHESKRKSGGRGSPSSHPTQAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.75 | 1.74608013254185 | 2.1e-8 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)