Host taxon 9606
Protein NP_996849.2
uncharacterized protein C5orf46 precursor
Homo sapiens
Gene C5orf46, UniProt Q6UWT4
>NP_996849.2|Haemophilus ducreyi 35000HP|uncharacterized protein C5orf46 precursor
MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRSTGFMEFDDNEGKHSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.97 | -2.97453712750765 | 2.1e-10 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)