Host taxon 9606
Protein NP_001278870.1
uncharacterized protein C3orf14 isoform a
Homo sapiens
Gene C3orf14, UniProt Q9HBI5
>NP_001278870.1|Haemophilus ducreyi 35000HP|uncharacterized protein C3orf14 isoform a
MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQTRIHPLPRPEVVSLETRYWASVEEYIPKWEQFLLGRAPYPFAVENQNEAENTIQNEAQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.6 | 0.596411729794551 | 0.046 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)